PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G168000.1.p
Common NameGLYMA_09G168000, LOC100809075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 723aa    MW: 79550.5 Da    PI: 6.7015
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G168000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.5e-202580156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +++t++q+++Le++F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Glyma.09G168000.1.p 25 KKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 80
                         678899***********************************************998 PP

2START175.63.1e-552254482206
                          HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          +a  a++e +++ + +ep+W+k +   + ++ d + + f+++++       ++ea+r+sgvv+m+  +lv  ++d + +W e ++     
  Glyma.09G168000.1.p 225 IASNAMEEMIRLLQTNEPLWMKGAdgrDVLDLDSYERMFPKANShlknpnVHVEASRDSGVVIMNGLTLVDMFMDPN-KWMELFPtivtM 313
                          67889*******************999889999999999998889999999**************************.999999999999 PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          a t+evissg      g lqlm+ elq+lsplv+ R+f+f+Ry++q ++g w+ivdvS d +q+++  ++  R+++lpSg  i++++ng+
  Glyma.09G168000.1.p 314 ARTIEVISSGmmgshsGSLQLMYEELQVLSPLVStREFYFLRYCQQIEQGLWAIVDVSYDFPQDNQ-FAPQYRSHRLPSGVFIQDMPNGY 402
                          *****************************************************************9.7999******************* PP

                          EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          skvtw+ehv+ ++++p h l+r l+ sg+a+ga++w+ tlqr ce+
  Glyma.09G168000.1.p 403 SKVTWIEHVEIEDKTPvHRLYRNLIYSGIAFGAQRWLTTLQRMCER 448
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.25E-20582IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-221084IPR009057Homeodomain-like
PROSITE profilePS5007118.0742282IPR001356Homeobox domain
SMARTSM003896.9E-192386IPR001356Homeobox domain
CDDcd000866.90E-192483No hitNo description
PfamPF000461.5E-172580IPR001356Homeobox domain
PROSITE patternPS0002705780IPR017970Homeobox, conserved site
PROSITE profilePS5084851.263215451IPR002913START domain
SuperFamilySSF559611.45E-37216449No hitNo description
CDDcd088753.17E-116219447No hitNo description
SMARTSM002345.9E-44224448IPR002913START domain
PfamPF018521.7E-47225448IPR002913START domain
Gene3DG3DSA:3.30.530.204.6E-9274430IPR023393START-like domain
SuperFamilySSF559611.99E-25469647No hitNo description
SuperFamilySSF559611.99E-25675714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MEFGSGSPGD HHHHHDGSSD SQRRKKRYHR HTANQIQRLE SMFKECPHPD EKQRLQLSRE  60
LGLAPRQIKF WFQNRRTQMK AQHERADNCA LRAENDKIRC ENIAIREALK NVICPSCGGP  120
PMNDDCYFDE QKLRLENAQL KEELDRVSSI AAKYIGRPIS QLPPVQPIHI SSLDLSMGTF  180
ASQGLGGPSL DLDLLPGSSS SPMLNVPPFQ PACLSDMDKS LMSDIASNAM EEMIRLLQTN  240
EPLWMKGADG RDVLDLDSYE RMFPKANSHL KNPNVHVEAS RDSGVVIMNG LTLVDMFMDP  300
NKWMELFPTI VTMARTIEVI SSGMMGSHSG SLQLMYEELQ VLSPLVSTRE FYFLRYCQQI  360
EQGLWAIVDV SYDFPQDNQF APQYRSHRLP SGVFIQDMPN GYSKVTWIEH VEIEDKTPVH  420
RLYRNLIYSG IAFGAQRWLT TLQRMCERIA CLMVTGNSTR DLGGVIPSPE GKRSMMKLAQ  480
RMVTNFCASI SASAGHRWTT LSGSGMNEIG VRVTVHKSSD PGQPNGVVLS AATTIWLPIP  540
PQTVFNFFKD EKKRPQWDVL SNGNAVQEVA HIANGPHPGN CISVLRAFNS SQNNMLILQE  600
SCVDSSGSLV VYCPVDLPAI NIAMSGEDPS YIPLLPSGFT ISPDGQADQD GGGASTSTST  660
GSRVMGGGSG PGSGGSLITV AFQILVSSLP SAKLNMESVT TVNSLIGNTV QHIKAALNCP  720
SS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587436.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0B2QVC40.0A0A0B2QVC4_GLYSO; Homeobox-leucine zipper protein HDG11
TrEMBLI1L3Y50.0I1L3Y5_SOYBN; Uncharacterized protein
STRINGGLYMA09G29810.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11